Neuropeptide Y/NPY Antibody orb234342 from Biorbyt

Product Specs
ItemNeuropeptide Y/NPY Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb234342
Quantity10 µg, 100 µg
ApplicationsIHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetNeuropeptide Y/NPY
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences
NCBI Full Gene Nameneuropeptide Y
NCBI Gene AliasesPYY4
ClonalityPolyclonal
Molecular Weight10851 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: WB: The detection limit for Neuropeptide Y is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Mouse, Rat, Human, By Heat Western blot, 0.1-0.5µg/ml, Human

Add to Compare List